PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000299555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 252aa    MW: 28586.2 Da    PI: 9.4035
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000299555genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.51.5e-24183232150
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEE CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvvei 50 
                    ldDg++WrKYG+K+vk+s++pr+YY+C+  gC+vkk+ver++edp+++ +
  MDP0000299555 183 LDDGFRWRKYGKKKVKSSPNPRNYYKCSVGGCHVKKRVERDREDPSIFGV 232
                    59********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-23176232IPR003657WRKY domain
SuperFamilySSF1182905.23E-21178232IPR003657WRKY domain
PROSITE profilePS5081122.986178230IPR003657WRKY domain
SMARTSM007741.5E-19183232IPR003657WRKY domain
PfamPF031062.9E-18184232IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MPSFSALCLC IICCGVIWLY GCGTCAIKYQ PTLALLGFQT IENVFWHRLS KTTSYMSIFK  60
NHERRIGLGL TTSRRPFKSX LASALXLRFI DKEGHEETLL LLSDGDIIYL SRDQRSVWPY  120
FTVTSCLVAT SEYLMIRKWL DEDPSFVGSE FSVQXSGFRA NEVGESGARS SQPGGSTIKV  180
EILDDGFRWR KYGKKKVKSS PNPRNYYKCS VGGCHVKKRV ERDREDPSIF GVWGPRKAXS  240
FVGLXRPFXD XT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-17164227161Probable WRKY transcription factor 4
2lex_A2e-17164227161Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-25WRKY DNA-binding protein 50